Recombinant Human DCTN5 Protein, GST-tagged
Cat.No. : | DCTN5-2415H |
Product Overview : | Human DCTN5 full-length ORF ( ADZ15660.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 20.1 kDa |
AA Sequence : | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCTN5 dynactin 5 (p25) [ Homo sapiens ] |
Official Symbol | DCTN5 |
Synonyms | DCTN5; dynactin 5 (p25); dynactin subunit 5; MGC3248; p25; dynactin 4; dynactin subunit p25; |
Gene ID | 84516 |
mRNA Refseq | NM_001199011 |
Protein Refseq | NP_001185940 |
MIM | 612962 |
UniProt ID | Q9BTE1 |
◆ Recombinant Proteins | ||
DCTN5-1172H | Recombinant Human DCTN5 Protein, GST/His-tagged | +Inquiry |
DCTN5-4190C | Recombinant Chicken DCTN5 | +Inquiry |
DCTN5-2241M | Recombinant Mouse DCTN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTN5-3059H | Recombinant Human DCTN5, T7-tagged | +Inquiry |
DCTN5-2404HF | Recombinant Full Length Human DCTN5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTN5-7038HCL | Recombinant Human DCTN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCTN5 Products
Required fields are marked with *
My Review for All DCTN5 Products
Required fields are marked with *
0
Inquiry Basket