"DCTN5" Related Products

Expand
Expand
Expand

Recombinant Human DCTN5 Protein, GST-tagged

Cat.No.: DCTN5-2415H
Product Overview: Human DCTN5 full-length ORF ( ADZ15660.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 20.1 kDa
AA Sequence: MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DCTN5 dynactin 5 (p25) [ Homo sapiens ]
Official Symbol: DCTN5
Synonyms: DCTN5; dynactin 5 (p25); dynactin subunit 5; MGC3248; p25; dynactin 4; dynactin subunit p25;
Gene ID: 84516
mRNA Refseq: NM_001199011
Protein Refseq: NP_001185940
MIM: 612962
UniProt ID: Q9BTE1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.