Recombinant Full Length Human DDR1 Protein, C-Flag-tagged
Cat.No. : | DDR1-1331HFL |
Product Overview : | Recombinant Full Length Human DDR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of tyrosine kinase receptors with homology to Dictyostelium discoideum protein discoidin I in their extracellular domain, and that are activated by various types of collagen. Expression of this protein is restricted to epithelial cells, particularly in the kidney, lung, gastrointestinal tract, and brain. In addition, it has been shown to be significantly overexpressed in several human tumors. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 100.9 kDa |
AA Sequence : | MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL NTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Full Length : | Full L. |
Gene Name | DDR1 discoidin domain receptor tyrosine kinase 1 [ Homo sapiens (human) ] |
Official Symbol | DDR1 |
Synonyms | CAK; DDR; NEP; HGK2; PTK3; RTK6; TRKE; CD167; EDDR1; MCK10; NTRK4; PTK3A |
Gene ID | 780 |
mRNA Refseq | NM_001954.5 |
Protein Refseq | NP_001945.3 |
MIM | 600408 |
UniProt ID | Q08345 |
◆ Recombinant Proteins | ||
Ddr1-6919M | Recombinant Mouse Ddr1 protein, hFc-tagged | +Inquiry |
DDR1-1331HFL | Recombinant Full Length Human DDR1 Protein, C-Flag-tagged | +Inquiry |
DDR1-212H | Recombinant Human DDR1 Protein, MYC/DDK-tagged | +Inquiry |
DDR1-816H | Recombinant Human DDR1 Protein, DDK-tagged | +Inquiry |
DDR1-5688H | Recombinant Human DDR1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDR1-2534HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
DDR1-001HCL | Recombinant Human DDR1 cell lysate | +Inquiry |
DDR1-401MCL | Recombinant Mouse DDR1 cell lysate | +Inquiry |
DDR1-1709MCL | Recombinant Mouse DDR1 cell lysate | +Inquiry |
DDR1-1081RCL | Recombinant Rat DDR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDR1 Products
Required fields are marked with *
My Review for All DDR1 Products
Required fields are marked with *
0
Inquiry Basket