Recombinant Full Length Human DEFA6 Protein
Cat.No. : | DEFA6-122HF |
Product Overview : | Recombinant full length Human DEFA6 , with N terminal proprietary tag; Predicted MW 37.07kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 100 amino acids |
Description : | Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. |
Form : | Liquid |
Molecular Mass : | 37.070kDa inclusive of tags |
AA Sequence : | MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ] |
Official Symbol | DEFA6 |
Synonyms | DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD6 |
Gene ID | 1671 |
mRNA Refseq | NM_001926 |
Protein Refseq | NP_001917 |
MIM | 600471 |
UniProt ID | Q01524 |
◆ Recombinant Proteins | ||
DEFA6-1944H | Recombinant Human DEFA6 Protein (Ala19-Cys99), N-GST tagged | +Inquiry |
DEFA6-2295M | Recombinant Mouse DEFA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFA6-122HF | Recombinant Full Length Human DEFA6 Protein | +Inquiry |
DEFA6-26996TH | Recombinant Human DEFA6 | +Inquiry |
Defa6-1329M | Recombinant Mouse Defa6 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA6-6990HCL | Recombinant Human DEFA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA6 Products
Required fields are marked with *
My Review for All DEFA6 Products
Required fields are marked with *