Recombinant Full Length Human DEFA6 Protein

Cat.No. : DEFA6-122HF
Product Overview : Recombinant full length Human DEFA6 , with N terminal proprietary tag; Predicted MW 37.07kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 100 amino acids
Description : Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel.
Form : Liquid
Molecular Mass : 37.070kDa inclusive of tags
AA Sequence : MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ]
Official Symbol DEFA6
Synonyms DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD6
Gene ID 1671
mRNA Refseq NM_001926
Protein Refseq NP_001917
MIM 600471
UniProt ID Q01524

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFA6 Products

Required fields are marked with *

My Review for All DEFA6 Products

Required fields are marked with *

0
cart-icon
0
compare icon