Recombinant Full Length Human DEFA6 Protein, GST-tagged
Cat.No. : | DEFA6-2429HF |
Product Overview : | Human DEFA6 full-length ORF ( NP_001917.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 100 amino acids |
Description : | Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEFA6 defensin, alpha 6, Paneth cell-specific [ Homo sapiens ] |
Official Symbol | DEFA6 |
Synonyms | DEFA6; defensin, alpha 6, Paneth cell-specific; defensin-6; DEF6; HD 6; defensin 6; HD-6; |
Gene ID | 1671 |
mRNA Refseq | NM_001926 |
Protein Refseq | NP_001917 |
MIM | 600471 |
UniProt ID | Q01524 |
◆ Recombinant Proteins | ||
DEFA6-747H | Recombinant Human DEFA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFA6-26996TH | Recombinant Human DEFA6 | +Inquiry |
DEFA6-1269HFL | Recombinant Full Length Human DEFA6 Protein, C-Flag-tagged | +Inquiry |
DEFA6-122HF | Recombinant Full Length Human DEFA6 Protein | +Inquiry |
DEFA6-1140H | Recombinant Human DEFA6 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA6-6990HCL | Recombinant Human DEFA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFA6 Products
Required fields are marked with *
My Review for All DEFA6 Products
Required fields are marked with *
0
Inquiry Basket