Recombinant Full Length Human DEFB125 Protein, GST-tagged
| Cat.No. : | DEFB125-2437HF |
| Product Overview : | Human DEFB125 full-length ORF (BAG34745.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 152 amino acids |
| Description : | Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeq, Nov 2014] |
| Molecular Mass : | 43.12 kDa |
| AA Sequence : | MLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAFPVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DEFB125 defensin, beta 125 [ Homo sapiens ] |
| Official Symbol | DEFB125 |
| Synonyms | DEFB-25 |
| Gene ID | 245938 |
| mRNA Refseq | NM_153325.2 |
| Protein Refseq | NP_697020.2 |
| UniProt ID | Q8N687 |
| ◆ Recombinant Proteins | ||
| DEFB125-2437HF | Recombinant Full Length Human DEFB125 Protein, GST-tagged | +Inquiry |
| DEFB125-2526H | Recombinant Human DEFB125 Protein, GST-tagged | +Inquiry |
| DEFB125-435H | Recombinant Human DEFB125 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEFB125-6983HCL | Recombinant Human DEFB125 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB125 Products
Required fields are marked with *
My Review for All DEFB125 Products
Required fields are marked with *
