Recombinant Human DEFB125 Protein, GST-tagged

Cat.No. : DEFB125-2526H
Product Overview : Human DEFB125 full-length ORF (BAG34745.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeq, Nov 2014]
Molecular Mass : 43.12 kDa
AA Sequence : MLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAFPVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFB125 defensin, beta 125 [ Homo sapiens ]
Official Symbol DEFB125
Synonyms DEFB-25
Gene ID 245938
mRNA Refseq NM_153325.2
Protein Refseq NP_697020.2
UniProt ID Q8N687

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB125 Products

Required fields are marked with *

My Review for All DEFB125 Products

Required fields are marked with *

0
cart-icon
0
compare icon