Recombinant Full Length Human DENR Protein, GST-tagged
Cat.No. : | DENR-2466HF |
Product Overview : | Human DENR full-length ORF ( NP_003668.2, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 198 amino acids |
Description : | This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DENR density-regulated protein [ Homo sapiens ] |
Official Symbol | DENR |
Synonyms | DENR; density-regulated protein; DRP; DRP1; SMAP 3; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3; SMAP-3; |
Gene ID | 8562 |
mRNA Refseq | NM_003677 |
Protein Refseq | NP_003668 |
MIM | 604550 |
UniProt ID | O43583 |
◆ Recombinant Proteins | ||
DENR-2816H | Recombinant Human DENR protein, His-SUMO-tagged | +Inquiry |
DENR-4516M | Recombinant Mouse DENR Protein | +Inquiry |
DENR-28065TH | Recombinant Human DENR, His-tagged | +Inquiry |
DENR-2466HF | Recombinant Full Length Human DENR Protein, GST-tagged | +Inquiry |
DENR-3927H | Recombinant Human DENR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DENR-6975HCL | Recombinant Human DENR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DENR Products
Required fields are marked with *
My Review for All DENR Products
Required fields are marked with *