Recombinant Full Length Human DHRS13 Protein, GST-tagged

Cat.No. : DHRS13-2521HF
Product Overview : Human DHRS13 full-length ORF ( NP_653284.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 327 amino acids
Description : DHRS13 (Dehydrogenase/Reductase 13) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH12.
Molecular Mass : 62.2 kDa
AA Sequence : MTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCGRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHRS13 dehydrogenase/reductase (SDR family) member 13 [ Homo sapiens ]
Official Symbol DHRS13
Synonyms DHRS13; dehydrogenase/reductase (SDR family) member 13; dehydrogenase/reductase SDR family member 13; MGC23280; SDR7C5; short chain dehydrogenase/reductase family 7C; member 5; short chain dehydrogenase/reductase family 7C, member 5;
Gene ID 147015
mRNA Refseq NM_144683
Protein Refseq NP_653284
MIM 616157
UniProt ID Q6UX07

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHRS13 Products

Required fields are marked with *

My Review for All DHRS13 Products

Required fields are marked with *

0
cart-icon