Recombinant Full Length Human DIRAS2 Protein, GST-tagged

Cat.No. : DIRAS2-2571HF
Product Overview : Human DIRAS2 full-length ORF ( NP_060064.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 199 amino acids
Description : DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]
Molecular Mass : 48.9 kDa
AA Sequence : MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIRAS2 DIRAS family, GTP-binding RAS-like 2 [ Homo sapiens ]
Official Symbol DIRAS2
Synonyms DIRAS2; DIRAS family, GTP-binding RAS-like 2; GTP-binding protein Di-Ras2; Di Ras2; DKFZp761C07121; distinct subgroup of the Ras family member 2; Di-Ras2;
Gene ID 54769
mRNA Refseq NM_017594
Protein Refseq NP_060064
MIM 607863
UniProt ID Q96HU8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIRAS2 Products

Required fields are marked with *

My Review for All DIRAS2 Products

Required fields are marked with *

0
cart-icon