Recombinant Full Length Human DMRTC2 Protein, GST-tagged

Cat.No. : DMRTC2-4041HF
Product Overview : Human DMRTC2 full-length ORF (BAB71473.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 224 amino acids
Description : DMRTC2 (DMRT Like Family C2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTC1.
Molecular Mass : 50.7 kDa
AA Sequence : MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLSQACECHKCVHILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKPCTQLQPVPSAPAELLWASAAQPSPGSLALVLDSGASWPLGPWTLAASRLLHATTSGVPPAVPRTCCLSASLPWL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMRTC2 DMRT-like family C2 [ Homo sapiens ]
Official Symbol DMRTC2
Synonyms DMRTC2; DMRT-like family C2; doublesex- and mab-3-related transcription factor C2;
Gene ID 63946
mRNA Refseq NM_001040283
Protein Refseq NP_001035373
MIM 614806
UniProt ID Q8IXT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMRTC2 Products

Required fields are marked with *

My Review for All DMRTC2 Products

Required fields are marked with *

0
cart-icon