Recombinant Full Length Human DNAJA2 Protein, C-Flag-tagged
Cat.No. : | DNAJA2-1657HFL |
Product Overview : | Recombinant Full Length Human DNAJA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYG EQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKN VLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKV IKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALC GFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSE LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DNAJA2 DnaJ heat shock protein family (Hsp40) member A2 [ Homo sapiens (human) ] |
Official Symbol | DNAJA2 |
Synonyms | DJ3; CPR3; DJA2; DNAJ; DNJ3; RDJ2; HIRIP4; PRO3015 |
Gene ID | 10294 |
mRNA Refseq | NM_005880.4 |
Protein Refseq | NP_005871.1 |
MIM | 611322 |
UniProt ID | O60884 |
◆ Recombinant Proteins | ||
Dnaja2-2592M | Recombinant Mouse Dnaja2 Protein, Myc/DDK-tagged | +Inquiry |
DNAJA2-28365TH | Recombinant Human DNAJA2, His-tagged | +Inquiry |
DNAJA2-772H | Recombinant Human DNAJA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJA2-4680M | Recombinant Mouse DNAJA2 Protein | +Inquiry |
DNAJA2-1276C | Recombinant Chicken DNAJA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJA2-6894HCL | Recombinant Human DNAJA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJA2 Products
Required fields are marked with *
My Review for All DNAJA2 Products
Required fields are marked with *
0
Inquiry Basket