Recombinant Full Length Human DNASE2 Protein, C-Flag-tagged
Cat.No. : | DNASE2-971HFL |
Product Overview : | Recombinant Full Length Human DNASE2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (low activity) and DNASE2*H (high activity), that differ at one nucleotide in the promoter region. The DNASE2*H allele is represented in this record. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM ARKPSRAYKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Lysosome |
Full Length : | Full L. |
Gene Name | DNASE2 deoxyribonuclease 2, lysosomal [ Homo sapiens (human) ] |
Official Symbol | DNASE2 |
Synonyms | DNL; DNL2; AIPCS; DNASE2A |
Gene ID | 1777 |
mRNA Refseq | NM_001375.3 |
Protein Refseq | NP_001366.1 |
MIM | 126350 |
UniProt ID | O00115 |
◆ Recombinant Proteins | ||
DNASE2-698H | Recombinant Human DNASE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNASE2-6475Z | Recombinant Zebrafish DNASE2 | +Inquiry |
DNASE2-971HFL | Recombinant Full Length Human DNASE2 Protein, C-Flag-tagged | +Inquiry |
DNASE2-776H | Recombinant Human DNASE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNASE2-216C | Recombinant Cynomolgus Monkey DNASE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE2-6863HCL | Recombinant Human DNASE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNASE2 Products
Required fields are marked with *
My Review for All DNASE2 Products
Required fields are marked with *
0
Inquiry Basket