Recombinant Full Length Human DPH3 Protein, GST-tagged
Cat.No. : | DPH3-4076HF |
Product Overview : | Human DPH3 full-length ORF ( ADZ15684.1, 1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 82 amino acids |
Description : | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009] |
Molecular Mass : | 9.1 kDa |
AA Sequence : | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPH3 DPH3, KTI11 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DPH3 |
Synonyms | DESR1; DPH3A; KTI11; ZCSL2; DELGIP; DELGIP1 |
Gene ID | 285381 |
mRNA Refseq | NM_206831 |
Protein Refseq | NP_996662 |
MIM | 608959 |
UniProt ID | Q96FX2 |
◆ Recombinant Proteins | ||
DPH3-1992H | Recombinant Human DPH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dph3-280M | Recombinant Mouse Dph3 Protein, MYC/DDK-tagged | +Inquiry |
DPH3-2834H | Recombinant Human DPH3 Protein, GST-tagged | +Inquiry |
DPH3-4076HF | Recombinant Full Length Human DPH3 Protein, GST-tagged | +Inquiry |
DPH3-7431Z | Recombinant Zebrafish DPH3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPH3-6836HCL | Recombinant Human DPH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPH3 Products
Required fields are marked with *
My Review for All DPH3 Products
Required fields are marked with *
0
Inquiry Basket