Recombinant Full Length Human DPH3 Protein, GST-tagged
| Cat.No. : | DPH3-4076HF | 
| Product Overview : | Human DPH3 full-length ORF ( ADZ15684.1, 1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 82 amino acids | 
| Description : | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009] | 
| Molecular Mass : | 9.1 kDa | 
| AA Sequence : | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DPH3 DPH3, KTI11 homolog (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | DPH3 | 
| Synonyms | DESR1; DPH3A; KTI11; ZCSL2; DELGIP; DELGIP1 | 
| Gene ID | 285381 | 
| mRNA Refseq | NM_206831 | 
| Protein Refseq | NP_996662 | 
| MIM | 608959 | 
| UniProt ID | Q96FX2 | 
| ◆ Recombinant Proteins | ||
| DPH3-2834H | Recombinant Human DPH3 Protein, GST-tagged | +Inquiry | 
| DPH3-1992H | Recombinant Human DPH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| DPH3-5600C | Recombinant Chicken DPH3 | +Inquiry | 
| DPH3-7431Z | Recombinant Zebrafish DPH3 | +Inquiry | 
| Dph3-280M | Recombinant Mouse Dph3 Protein, MYC/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DPH3-6836HCL | Recombinant Human DPH3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DPH3 Products
Required fields are marked with *
My Review for All DPH3 Products
Required fields are marked with *
  
        
    
      
            