Recombinant Full Length Human DPP3 Protein, Flag-tagged
Cat.No. : | DPP3-15HFL |
Product Overview : | Recombinant Full Length Human DPP3 Protein, Flag-tagged, expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293T |
Tag : | Flag |
Description : | This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene. |
Source : | HEK293T |
Species : | Human |
Tag : | Flag |
Molecular Mass : | 82.4 kDa |
AA Sequence : | MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQ DPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEV RGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKP YYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQ YIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASA EQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ REKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYR SGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPE AFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKS TGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSF SERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80°C. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method |
Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Gene Name | DPP3 dipeptidyl peptidase 3 [ Homo sapiens (human) ] |
Official Symbol | DPP3 |
Synonyms | Dipeptidyl aminopeptidase III; Dipeptidyl arylamidase III; dipeptidyl peptidase 3; Dipeptidyl peptidase III; dipeptidylpeptidase 3; dipeptidyl-peptidase 3; dipeptidylpeptidase III; DPP III; DPP3; DPPIII; EC 3.4.14.4; FLJ11387; FLJ22331 |
Gene ID | 10072 |
mRNA Refseq | NM_005700 |
Protein Refseq | NP_005691 |
MIM | 606818 |
UniProt ID | Q9NY33 |
◆ Recombinant Proteins | ||
DPP3-790Z | Recombinant Zebrafish DPP3 | +Inquiry |
DPP3-1601R | Recombinant Rat DPP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPP3-28433TH | Recombinant Human DPP3 | +Inquiry |
DPP3-43H | Recombinant Human DPP3 protein, His-tagged | +Inquiry |
DPP3-515H | Recombinant Human Dipeptidyl-Peptidase 3, GST-tagged | +Inquiry |
◆ Native Proteins | ||
DPP3-01HFL | Recombinant Full Length Human DPP3 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPP3-6831HCL | Recombinant Human DPP3 293 Cell Lysate | +Inquiry |
DPP3-6832HCL | Recombinant Human DPP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPP3 Products
Required fields are marked with *
My Review for All DPP3 Products
Required fields are marked with *