Recombinant Full Length Human DRAP1 Protein, GST-tagged

Cat.No. : DRAP1-4181HF
Product Overview : Human DRAP1 full-length ORF ( NP_006433.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 205 amino acids
Description : Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008]
Molecular Mass : 48.7 kDa
AA Sequence : MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ]
Official Symbol DRAP1
Synonyms DRAP1; DR1-associated protein 1 (negative cofactor 2 alpha); dr1-associated corepressor; DR1 associated corepressor; NC2 alpha; negative cofactor 2 alpha; negative co-factor 2-alpha; NC2-alpha;
Gene ID 10589
mRNA Refseq NM_006442
Protein Refseq NP_006433
MIM 602289
UniProt ID Q14919

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DRAP1 Products

Required fields are marked with *

My Review for All DRAP1 Products

Required fields are marked with *

0
cart-icon