Recombinant Full Length Human DRAP1 Protein, GST-tagged
| Cat.No. : | DRAP1-4181HF |
| Product Overview : | Human DRAP1 full-length ORF ( NP_006433.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 205 amino acids |
| Description : | Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 48.7 kDa |
| AA Sequence : | MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ] |
| Official Symbol | DRAP1 |
| Synonyms | DRAP1; DR1-associated protein 1 (negative cofactor 2 alpha); dr1-associated corepressor; DR1 associated corepressor; NC2 alpha; negative cofactor 2 alpha; negative co-factor 2-alpha; NC2-alpha; |
| Gene ID | 10589 |
| mRNA Refseq | NM_006442 |
| Protein Refseq | NP_006433 |
| MIM | 602289 |
| UniProt ID | Q14919 |
| ◆ Recombinant Proteins | ||
| DRAP1-1153R | Recombinant Rhesus Macaque DRAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DRAP1-4181HF | Recombinant Full Length Human DRAP1 Protein, GST-tagged | +Inquiry |
| DRAP1-11589Z | Recombinant Zebrafish DRAP1 | +Inquiry |
| DRAP1-2670H | Recombinant Human DRAP1, His-tagged | +Inquiry |
| DRAP1-1328R | Recombinant Rhesus monkey DRAP1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DRAP1-6819HCL | Recombinant Human DRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRAP1 Products
Required fields are marked with *
My Review for All DRAP1 Products
Required fields are marked with *
