Recombinant Full Length Human DRAP1 Protein, GST-tagged
Cat.No. : | DRAP1-4181HF |
Product Overview : | Human DRAP1 full-length ORF ( NP_006433.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 205 amino acids |
Description : | Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ] |
Official Symbol | DRAP1 |
Synonyms | DRAP1; DR1-associated protein 1 (negative cofactor 2 alpha); dr1-associated corepressor; DR1 associated corepressor; NC2 alpha; negative cofactor 2 alpha; negative co-factor 2-alpha; NC2-alpha; |
Gene ID | 10589 |
mRNA Refseq | NM_006442 |
Protein Refseq | NP_006433 |
MIM | 602289 |
UniProt ID | Q14919 |
◆ Recombinant Proteins | ||
DRAP1-254H | Recombinant Human DRAP1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
DRAP1-1613R | Recombinant Rat DRAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DRAP1-1212H | Recombinant Human DRAP1 Protein (4-198 aa), GST-tagged | +Inquiry |
DRAP1-1954R | Recombinant Rat DRAP1 Protein | +Inquiry |
DRAP1-4181HF | Recombinant Full Length Human DRAP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRAP1-6819HCL | Recombinant Human DRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRAP1 Products
Required fields are marked with *
My Review for All DRAP1 Products
Required fields are marked with *
0
Inquiry Basket