Recombinant Full Length Human DUSP11 Protein, GST-tagged
| Cat.No. : | DUSP11-4090HF |
| Product Overview : | Human DUSP11 full-length ORF ( NP_003575.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 330 amino acids |
| Description : | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus and binds directly to RNA and splicing factors, and thus it is suggested to participate in nuclear mRNA metabolism. [provided by RefSeq, Sep 2008] |
| Molecular Mass : | 65.3 kDa |
| AA Sequence : | MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNSSVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DUSP11 dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [ Homo sapiens ] |
| Official Symbol | DUSP11 |
| Synonyms | DUSP11; dual specificity phosphatase 11 (RNA/RNP complex 1-interacting); RNA/RNP complex-1-interacting phosphatase; PIR1; RNA/RNP complex-interacting phosphatase; dual specificity protein phosphatase 11; serine/threonine specific protein phosphatase; phosphatase that interacts with RNA/RNP complex 1; |
| Gene ID | 8446 |
| mRNA Refseq | NM_003584 |
| Protein Refseq | NP_003575 |
| MIM | 603092 |
| UniProt ID | O75319 |
| ◆ Recombinant Proteins | ||
| DUSP11-4090HF | Recombinant Full Length Human DUSP11 Protein, GST-tagged | +Inquiry |
| DUSP11-4876M | Recombinant Mouse DUSP11 Protein | +Inquiry |
| DUSP11-2236H | Recombinant Human DUSP11 Protein (Gly75-Trp255), N-His tagged | +Inquiry |
| DUSP11-1972R | Recombinant Rat DUSP11 Protein | +Inquiry |
| DUSP11-3066H | Recombinant Human DUSP11 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUSP11-6783HCL | Recombinant Human DUSP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP11 Products
Required fields are marked with *
My Review for All DUSP11 Products
Required fields are marked with *
