Recombinant Full Length Human DYNC1LI1 Protein, GST-tagged
| Cat.No. : | DYNC1LI1-4145HF |
| Product Overview : | Human DYNC1LI1 full-length ORF (1 a.a. - 523 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 523 amino acids |
| Description : | The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016] |
| Molecular Mass : | 83 kDa |
| AA Sequence : | MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDKDRDDQTRCNVWILDGDLYHKGLLKFSLDAVSLKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQKPVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DYNC1LI1 dynein, cytoplasmic 1, light intermediate chain 1 [ Homo sapiens ] |
| Official Symbol | DYNC1LI1 |
| Synonyms | DYNC1LI1; dynein, cytoplasmic 1, light intermediate chain 1; DNCLI1, dynein, cytoplasmic, light intermediate polypeptide 1; cytoplasmic dynein 1 light intermediate chain 1; DLC-A; dynein light chain A; dynein light chain-A; dynein light intermediate chain 1, cytosolic; dynein, cytoplasmic, light intermediate polypeptide 1; LIC1; DNCLI1; FLJ10219; |
| Gene ID | 51143 |
| mRNA Refseq | NM_016141 |
| Protein Refseq | NP_057225 |
| MIM | 615890 |
| UniProt ID | Q9Y6G9 |
| ◆ Recombinant Proteins | ||
| DYNC1LI1-4145HF | Recombinant Full Length Human DYNC1LI1 Protein, GST-tagged | +Inquiry |
| DYNC1LI1-1641R | Recombinant Rat DYNC1LI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DYNC1LI1-5919Z | Recombinant Zebrafish DYNC1LI1 | +Inquiry |
| DYNC1LI1-077H | Recombinant Human DYNC1LI1 protein, GST-tagged | +Inquiry |
| DYNC1LI1-4024C | Recombinant Chicken DYNC1LI1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DYNC1LI1-6762HCL | Recombinant Human DYNC1LI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNC1LI1 Products
Required fields are marked with *
My Review for All DYNC1LI1 Products
Required fields are marked with *



