Recombinant Full Length Human DZIP3 Protein, GST-tagged

Cat.No. : DZIP3-4105HF
Product Overview : Human DZIP3 partial ORF ( NP_055463, 1021 a.a. - 1120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 1120 amino acids
Description : DZIP3 (DAZ Interacting Zinc Finger Protein 3) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include poly(A) RNA binding and ligase activity. An important paralog of this gene is TTC3.
Molecular Mass : 36.74 kDa
AA Sequence : PSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAYGKSLSELTFDEIVCKISQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DZIP3 DAZ interacting protein 3, zinc finger [ Homo sapiens ]
Official Symbol DZIP3
Synonyms DZIP3; DAZ interacting protein 3, zinc finger; E3 ubiquitin-protein ligase DZIP3; hRUL138; human RNA binding ubiquitin ligase of 138 kDa; PPP1R66; protein phosphatase 1; regulatory subunit 66; UURF2 ubiquitin ligase; DAZ-interacting protein 3; zinc finger DAZ interacting protein 3; RNA-binding ubiquitin ligase of 138 kDa; protein phosphatase 1, regulatory subunit 66; human RNA-binding ubiquitin ligase of 138 kDa; UURF2; FLJ13327; FLJ57977; FLJ58022; FLJ58223; KIAA0675;
Gene ID 9666
mRNA Refseq NM_014648
Protein Refseq NP_055463
MIM 608672
UniProt ID Q86Y13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DZIP3 Products

Required fields are marked with *

My Review for All DZIP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon