Recombinant Full Length Human DZIP3 Protein, GST-tagged
Cat.No. : | DZIP3-4105HF |
Product Overview : | Human DZIP3 partial ORF ( NP_055463, 1021 a.a. - 1120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 1120 amino acids |
Description : | DZIP3 (DAZ Interacting Zinc Finger Protein 3) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include poly(A) RNA binding and ligase activity. An important paralog of this gene is TTC3. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAYGKSLSELTFDEIVCKISQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DZIP3 DAZ interacting protein 3, zinc finger [ Homo sapiens ] |
Official Symbol | DZIP3 |
Synonyms | DZIP3; DAZ interacting protein 3, zinc finger; E3 ubiquitin-protein ligase DZIP3; hRUL138; human RNA binding ubiquitin ligase of 138 kDa; PPP1R66; protein phosphatase 1; regulatory subunit 66; UURF2 ubiquitin ligase; DAZ-interacting protein 3; zinc finger DAZ interacting protein 3; RNA-binding ubiquitin ligase of 138 kDa; protein phosphatase 1, regulatory subunit 66; human RNA-binding ubiquitin ligase of 138 kDa; UURF2; FLJ13327; FLJ57977; FLJ58022; FLJ58223; KIAA0675; |
Gene ID | 9666 |
mRNA Refseq | NM_014648 |
Protein Refseq | NP_055463 |
MIM | 608672 |
UniProt ID | Q86Y13 |
◆ Recombinant Proteins | ||
DZIP3-3001H | Recombinant Human DZIP3 Protein, GST-tagged | +Inquiry |
DZIP3-4105HF | Recombinant Full Length Human DZIP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DZIP3-6744HCL | Recombinant Human DZIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DZIP3 Products
Required fields are marked with *
My Review for All DZIP3 Products
Required fields are marked with *