| Description : |
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner. Two transcript variants encoding different isoforms have been found for this gene. |
| Source : |
In Vitro Cell Free System |
| Species : |
Human |
| Form : |
Liquid |
| Molecular Mass : |
40.740kDa inclusive of tags |
| Protein Length : |
133 amino acids |
| AA Sequence : |
MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFS SSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKC LLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVI LFASCTKLIFSKV |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
