Recombinant Human E2F3 Protein, GST-tagged

Cat.No. : E2F3-3006H
Product Overview : Human E2F3 full-length ORF ( AAH16847, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
Molecular Mass : 40.37 kDa
AA Sequence : MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name E2F3 E2F transcription factor 3 [ Homo sapiens ]
Official Symbol E2F3
Synonyms E2F3; E2F transcription factor 3; transcription factor E2F3; E2F-3; KIAA0075; MGC104598; DKFZp686C18211;
Gene ID 1871
mRNA Refseq NM_001243076
Protein Refseq NP_001230005
MIM 600427
UniProt ID O00716

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E2F3 Products

Required fields are marked with *

My Review for All E2F3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon