Recombinant Full Length Human EBAG9 Protein, GST-tagged
Cat.No. : | EBAG9-4136HF |
Product Overview : | Human EBAG9 full-length ORF ( AAH17729, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 213 amino acids |
Description : | This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 49.17 kDa |
AA Sequence : | MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EBAG9 estrogen receptor binding site associated, antigen, 9 [ Homo sapiens ] |
Official Symbol | EBAG9 |
Synonyms | EBAG9; estrogen receptor binding site associated, antigen, 9; receptor-binding cancer antigen expressed on SiSo cells; EB9; RCAS1; cancer associated surface antigen; cancer-associated surface antigen RCAS1; estrogen receptor-binding fragment-associated gene 9 protein; PDAF; |
Gene ID | 9166 |
mRNA Refseq | NM_004215 |
Protein Refseq | NP_004206 |
MIM | 605772 |
UniProt ID | O00559 |
◆ Recombinant Proteins | ||
EBAG9-11317Z | Recombinant Zebrafish EBAG9 | +Inquiry |
EBAG9-2638C | Recombinant Chicken EBAG9 | +Inquiry |
EBAG9-1997R | Recombinant Rat EBAG9 Protein | +Inquiry |
EBAG9-385H | Recombinant Human Estrogen Receptor Binding Site Associated, Antigen, 9, His-tagged | +Inquiry |
EBAG9-2613M | Recombinant Mouse EBAG9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBAG9-6737HCL | Recombinant Human EBAG9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBAG9 Products
Required fields are marked with *
My Review for All EBAG9 Products
Required fields are marked with *
0
Inquiry Basket