Recombinant Human EBAG9 protein, His-SUMO-tagged
Cat.No. : | EBAG9-2831H |
Product Overview : | Recombinant Human EBAG9 protein(O00559)(28-213aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 28-213aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EBAG9 estrogen receptor binding site associated, antigen, 9 [ Homo sapiens ] |
Official Symbol | EBAG9 |
Synonyms | EBAG9; estrogen receptor binding site associated, antigen, 9; receptor-binding cancer antigen expressed on SiSo cells; EB9; RCAS1; cancer associated surface antigen; cancer-associated surface antigen RCAS1; estrogen receptor-binding fragment-associated gene 9 protein; PDAF; |
Gene ID | 9166 |
mRNA Refseq | NM_004215 |
Protein Refseq | NP_004206 |
MIM | 605772 |
UniProt ID | O00559 |
◆ Recombinant Proteins | ||
EBAG9-4953M | Recombinant Mouse EBAG9 Protein | +Inquiry |
EBAG9-2831H | Recombinant Human EBAG9 protein, His-SUMO-tagged | +Inquiry |
EBAG9-4136HF | Recombinant Full Length Human EBAG9 Protein, GST-tagged | +Inquiry |
EBAG9-2613M | Recombinant Mouse EBAG9 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL26176HF | Recombinant Full Length Human Receptor-Binding Cancer Antigen Expressed On Siso Cells(Ebag9) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBAG9-6737HCL | Recombinant Human EBAG9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EBAG9 Products
Required fields are marked with *
My Review for All EBAG9 Products
Required fields are marked with *