Recombinant Full Length Human Receptor-Binding Cancer Antigen Expressed On Siso Cells(Ebag9) Protein, His-Tagged
Cat.No. : | RFL26176HF |
Product Overview : | Recombinant Full Length Human Receptor-binding cancer antigen expressed on SiSo cells(EBAG9) Protein (O00559) (1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-213) |
Form : | Lyophilized powder |
AA Sequence : | MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EBAG9 |
Synonyms | BAG9; Cancer associated surface antigen; Cancer associated surface antigen RCAS1; Cancer-associated surface antigen RCAS1; EB9; EBAG 9; EBAG9; Estrogen receptor binding fragment associated gene 9 protein; Estrogen receptor binding site associated antigen |
UniProt ID | O00559 |
◆ Recombinant Proteins | ||
RFL26176HF | Recombinant Full Length Human Receptor-Binding Cancer Antigen Expressed On Siso Cells(Ebag9) Protein, His-Tagged | +Inquiry |
EBAG9-4953M | Recombinant Mouse EBAG9 Protein | +Inquiry |
EBAG9-2831H | Recombinant Human EBAG9 protein, His-SUMO-tagged | +Inquiry |
EBAG9-2638C | Recombinant Chicken EBAG9 | +Inquiry |
EBAG9-1997R | Recombinant Rat EBAG9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBAG9-6737HCL | Recombinant Human EBAG9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBAG9 Products
Required fields are marked with *
My Review for All EBAG9 Products
Required fields are marked with *
0
Inquiry Basket