Recombinant Full Length Human ECHS1 Protein, C-Flag-tagged
Cat.No. : | ECHS1-1352HFL |
Product Overview : | Recombinant Full Length Human ECHS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.2 kDa |
AA Sequence : | MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELN QALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFG GGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVS KICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFV EKRKANFKDQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | beta-Alanine metabolism, Butanoate metabolism, Fatty acid elongation in mitochondria, Fatty acid metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | ECHS1 enoyl-CoA hydratase, short chain 1 [ Homo sapiens (human) ] |
Official Symbol | ECHS1 |
Synonyms | SCEH; mECH; mECH1; ECHS1D |
Gene ID | 1892 |
mRNA Refseq | NM_004092.4 |
Protein Refseq | NP_004083.3 |
MIM | 602292 |
UniProt ID | P30084 |
◆ Recombinant Proteins | ||
ECHS1-2004R | Recombinant Rat ECHS1 Protein | +Inquiry |
Echs1-2328M | Recombinant Mouse Echs1 protein, His&Myc-tagged | +Inquiry |
ECHS1-4170HF | Recombinant Full Length Human ECHS1 Protein, GST-tagged | +Inquiry |
ECHS1-2625M | Recombinant Mouse ECHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECHS1-4803C | Recombinant Chicken ECHS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECHS1 Products
Required fields are marked with *
My Review for All ECHS1 Products
Required fields are marked with *
0
Inquiry Basket