Recombinant Human EFNB1 protein, GST-tagged
Cat.No. : | EFNB1-301454H |
Product Overview : | Recombinant Human EFNB1 (32-239 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu32-Ala239 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | EFNB1 ephrin-B1 [ Homo sapiens ] |
Official Symbol | EFNB1 |
Synonyms | EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia) , EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782; |
Gene ID | 1947 |
mRNA Refseq | NM_004429 |
Protein Refseq | NP_004420 |
MIM | 300035 |
UniProt ID | P98172 |
◆ Recombinant Proteins | ||
EFNB1-234H | Recombinant Human EFNB1 Protein, His and Strep-tagged | +Inquiry |
RFL23000XF | Recombinant Full Length Xenopus Laevis Ephrin-B1(Efnb1) Protein, His-Tagged | +Inquiry |
RFL25523HF | Recombinant Full Length Human Ephrin-B1(Efnb1) Protein, His-Tagged | +Inquiry |
EFNB1-1077R | Active Recombinant Rat EFNB1 Protein, His-tagged | +Inquiry |
EFNB1-6592C | Recombinant Chicken EFNB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNB1 Products
Required fields are marked with *
My Review for All EFNB1 Products
Required fields are marked with *