Recombinant Full Length Human EHF Protein, GST-tagged

• Cat.No.: EHF-4323HF
• Product Overview: Human EHF full-length ORF ( NP_036285.2, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 300 amino acids
• Description: This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be involved in epithelial differentiation and carcinogenesis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
• Molecular Mass: 61.3 kDa
• AA Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EHF ets homologous factor [ Homo sapiens ]
• Official Symbol: EHF
• Synonyms: EHF; ets homologous factor; ETS homologous factor; epithelium specific ets factor 3; ESE3; ESE3 transcription factor; ESEJ; hEHF; ETS domain-containing transcription factor; epithelium-specific Ets transcription factor 3; ESE3B
• Gene ID: 26298
• mRNA Refseq: NM_001206615
• Protein Refseq: NP_001193544
• MIM: 605439
• UniProt ID: Q9NZC4