Recombinant Full Length Human EHF Protein, GST-tagged
| Cat.No. : | EHF-4323HF |
| Product Overview : | Human EHF full-length ORF ( NP_036285.2, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 300 amino acids |
| Description : | This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be involved in epithelial differentiation and carcinogenesis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
| Molecular Mass : | 61.3 kDa |
| AA Sequence : | MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EHF ets homologous factor [ Homo sapiens ] |
| Official Symbol | EHF |
| Synonyms | EHF; ets homologous factor; ETS homologous factor; epithelium specific ets factor 3; ESE3; ESE3 transcription factor; ESEJ; hEHF; ETS domain-containing transcription factor; epithelium-specific Ets transcription factor 3; ESE3B; |
| Gene ID | 26298 |
| mRNA Refseq | NM_001206615 |
| Protein Refseq | NP_001193544 |
| MIM | 605439 |
| UniProt ID | Q9NZC4 |
| ◆ Recombinant Proteins | ||
| Ehf-5649M | Recombinant Mouse Ehf Protein (Met1-Asn127), C-His tagged | +Inquiry |
| EHF-12336H | Recombinant Human EHF, GST-tagged | +Inquiry |
| EHF-4323HF | Recombinant Full Length Human EHF Protein, GST-tagged | +Inquiry |
| EHF-4967C | Recombinant Chicken EHF | +Inquiry |
| EHF-3133H | Recombinant Human EHF Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EHF-6687HCL | Recombinant Human EHF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EHF Products
Required fields are marked with *
My Review for All EHF Products
Required fields are marked with *



