Recombinant Full Length Human EIF3A Protein, GST-tagged
Cat.No. : | EIF3A-4239HF |
Product Overview : | Human EIF3S10 partial ORF ( NP_003741, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 75 amino acids |
Description : | EIF3A (Eukaryotic Translation Initiation Factor 3 Subunit A) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity. |
Molecular Mass : | 33.99 kDa |
AA Sequence : | MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF3A eukaryotic translation initiation factor 3, subunit A [ Homo sapiens ] |
Official Symbol | EIF3A |
Synonyms | EIF3A; eukaryotic translation initiation factor 3, subunit A; EIF3, EIF3S10, eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa; eukaryotic translation initiation factor 3 subunit A; eIF3 p170; eIF3 theta; eIF3a; KIAA0139; TIF32; eIF3 p167; eIF3 p180; eIF3 p185; eIF-3-theta; EIF3, p180 subunit; centrosomin homolog; cytoplasmic protein p167; eukaryotic translation initiation factor 3 subunit 10; eukaryotic translation initiation factor 3, subunit 10, 170kD; eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD); eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa; eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD); EIF3; P167; p180; p185; EIF3S10; eIF3-p170; eIF3-theta; |
Gene ID | 8661 |
mRNA Refseq | NM_003750 |
Protein Refseq | NP_003741 |
MIM | 602039 |
UniProt ID | Q14152 |
◆ Recombinant Proteins | ||
EIF3A-2055R | Recombinant Rat EIF3A Protein | +Inquiry |
EIF3A-5091M | Recombinant Mouse EIF3A Protein | +Inquiry |
Eif3a-1929M | Recombinant Mouse Eif3a protein, His & T7-tagged | +Inquiry |
EIF3A-2708M | Recombinant Mouse EIF3A Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3A-4239HF | Recombinant Full Length Human EIF3A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3A-6664HCL | Recombinant Human EIF3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3A Products
Required fields are marked with *
My Review for All EIF3A Products
Required fields are marked with *