Recombinant Full Length Human EIF3A Protein, GST-tagged

Cat.No. : EIF3A-4239HF
Product Overview : Human EIF3S10 partial ORF ( NP_003741, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 75 amino acids
Description : EIF3A (Eukaryotic Translation Initiation Factor 3 Subunit A) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity.
Molecular Mass : 33.99 kDa
AA Sequence : MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF3A eukaryotic translation initiation factor 3, subunit A [ Homo sapiens ]
Official Symbol EIF3A
Synonyms EIF3A; eukaryotic translation initiation factor 3, subunit A; EIF3, EIF3S10, eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa; eukaryotic translation initiation factor 3 subunit A; eIF3 p170; eIF3 theta; eIF3a; KIAA0139; TIF32; eIF3 p167; eIF3 p180; eIF3 p185; eIF-3-theta; EIF3, p180 subunit; centrosomin homolog; cytoplasmic protein p167; eukaryotic translation initiation factor 3 subunit 10; eukaryotic translation initiation factor 3, subunit 10, 170kD; eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD); eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa; eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD); EIF3; P167; p180; p185; EIF3S10; eIF3-p170; eIF3-theta;
Gene ID 8661
mRNA Refseq NM_003750
Protein Refseq NP_003741
MIM 602039
UniProt ID Q14152

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3A Products

Required fields are marked with *

My Review for All EIF3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon