Recombinant Full Length Human EIF3D Protein, C-Flag-tagged
Cat.No. : | EIF3D-1694HFL |
Product Overview : | Recombinant Full Length Human EIF3D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYA YFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKF QKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRIT TRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDK RDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDK NEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGI LRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEETTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EIF3D eukaryotic translation initiation factor 3 subunit D [ Homo sapiens (human) ] |
Official Symbol | EIF3D |
Synonyms | EIF3S7; eIF3-p66; eIF3-zeta |
Gene ID | 8664 |
mRNA Refseq | NM_003753.4 |
Protein Refseq | NP_003744.1 |
MIM | 603915 |
UniProt ID | O15371 |
◆ Recombinant Proteins | ||
EIF3D-896H | Recombinant Human EIF3D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF3D-2711M | Recombinant Mouse EIF3D Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3D-12366H | Recombinant Human EIF3D protein, GST-tagged | +Inquiry |
EIF3D-26387TH | Recombinant Human EIF3D, His-tagged | +Inquiry |
Eif3d-2778M | Recombinant Mouse Eif3d Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3D-6663HCL | Recombinant Human EIF3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF3D Products
Required fields are marked with *
My Review for All EIF3D Products
Required fields are marked with *
0
Inquiry Basket