Recombinant Full Length Human EIF3K Protein, GST-tagged
Cat.No. : | EIF3K-4277HF |
Product Overview : | Human EIF3S12 full-length ORF ( NP_037366.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 218 amino acids |
Description : | The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLQAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF3K eukaryotic translation initiation factor 3, subunit K [ Homo sapiens ] |
Official Symbol | EIF3K |
Synonyms | EIF3K; eukaryotic translation initiation factor 3, subunit K; EIF3S12, eukaryotic translation initiation factor 3, subunit 12; eukaryotic translation initiation factor 3 subunit K; ARG134; eIF3k; HSPC029; M9; PLAC 24; PRO1474; PTD001; eIF-3 p25; eIF-3 p28; muscle specific; muscle-specific gene M9 protein; eukaryotic translation initiation factor 3 subunit 12; eukaryotic translation initiation factor 3, subunit 12; PLAC24; EIF3S12; MSTP001; PLAC-24; EIF3-p28; |
Gene ID | 27335 |
mRNA Refseq | NM_013234 |
Protein Refseq | NP_037366 |
MIM | 609596 |
UniProt ID | Q9UBQ5 |
◆ Recombinant Proteins | ||
EIF3K-2204H | Recombinant Human EIF3K protein, His&GST-tagged | +Inquiry |
EIF3K-018H | Recombinant Full Length Human eukaryotic translation initiation factor 3, subunit K Protein, His&Flag&StrepII tagged | +Inquiry |
EIF3K-2713M | Recombinant Mouse EIF3K Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3K-8745H | Recombinant Human EIF3K protein | +Inquiry |
EIF3K-3191H | Recombinant Human EIF3K Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3K-001HCL | Recombinant Human EIF3K cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF3K Products
Required fields are marked with *
My Review for All EIF3K Products
Required fields are marked with *
0
Inquiry Basket