Recombinant Full Length Human EIF3K Protein, GST-tagged

Cat.No. : EIF3K-4277HF
Product Overview : Human EIF3S12 full-length ORF ( NP_037366.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 218 amino acids
Description : The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008]
Molecular Mass : 51.5 kDa
AA Sequence : MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLQAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF3K eukaryotic translation initiation factor 3, subunit K [ Homo sapiens ]
Official Symbol EIF3K
Synonyms EIF3K; eukaryotic translation initiation factor 3, subunit K; EIF3S12, eukaryotic translation initiation factor 3, subunit 12; eukaryotic translation initiation factor 3 subunit K; ARG134; eIF3k; HSPC029; M9; PLAC 24; PRO1474; PTD001; eIF-3 p25; eIF-3 p28; muscle specific; muscle-specific gene M9 protein; eukaryotic translation initiation factor 3 subunit 12; eukaryotic translation initiation factor 3, subunit 12; PLAC24; EIF3S12; MSTP001; PLAC-24; EIF3-p28;
Gene ID 27335
mRNA Refseq NM_013234
Protein Refseq NP_037366
MIM 609596
UniProt ID Q9UBQ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3K Products

Required fields are marked with *

My Review for All EIF3K Products

Required fields are marked with *

0
cart-icon