Recombinant Full Length Human EIF4E2 Protein, GST-tagged

Cat.No. : EIF4E2-4290HF
Product Overview : Human EIF4E2 full-length ORF ( AAH05874, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 245 amino acids
Description : EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2) is a Protein Coding gene. Among its related pathways are Interferon gamma signaling and Innate Immune System. GO annotations related to this gene include poly(A) RNA binding and ubiquitin protein ligase binding. An important paralog of this gene is EIF4E.
Molecular Mass : 52.69 kDa
AA Sequence : MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ]
Official Symbol EIF4E2
Synonyms EIF4E2; eukaryotic translation initiation factor 4E family member 2; EIF4EL3, eukaryotic translation initiation factor 4E like 3; eukaryotic translation initiation factor 4E type 2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; eukaryotic translation initiation factor 4E-like 3; eukaryotic translation initiation factor 4E member 2; eukaryotic translation initiation factor 4E homologous protein; 4E-LP; EIF4EL3;
Gene ID 9470
mRNA Refseq NM_004846
Protein Refseq NP_004837
MIM 605895
UniProt ID O60573

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4E2 Products

Required fields are marked with *

My Review for All EIF4E2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon