Recombinant Full Length Human EIF4E2 Protein, GST-tagged
Cat.No. : | EIF4E2-4290HF |
Product Overview : | Human EIF4E2 full-length ORF ( AAH05874, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 245 amino acids |
Description : | EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2) is a Protein Coding gene. Among its related pathways are Interferon gamma signaling and Innate Immune System. GO annotations related to this gene include poly(A) RNA binding and ubiquitin protein ligase binding. An important paralog of this gene is EIF4E. |
Molecular Mass : | 52.69 kDa |
AA Sequence : | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ] |
Official Symbol | EIF4E2 |
Synonyms | EIF4E2; eukaryotic translation initiation factor 4E family member 2; EIF4EL3, eukaryotic translation initiation factor 4E like 3; eukaryotic translation initiation factor 4E type 2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; eukaryotic translation initiation factor 4E-like 3; eukaryotic translation initiation factor 4E member 2; eukaryotic translation initiation factor 4E homologous protein; 4E-LP; EIF4EL3; |
Gene ID | 9470 |
mRNA Refseq | NM_004846 |
Protein Refseq | NP_004837 |
MIM | 605895 |
UniProt ID | O60573 |
◆ Recombinant Proteins | ||
EIF4E2-2285Z | Recombinant Zebrafish EIF4E2 | +Inquiry |
EIF4E2-01H | Recombinant Human EIF4E2 protein, Myc/DDK-tagged | +Inquiry |
EIF4E2-2160H | Recombinant Human EIF4E2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF4E2-1429R | Recombinant Rhesus monkey EIF4E2 Protein, His-tagged | +Inquiry |
EIF4E2-1253R | Recombinant Rhesus Macaque EIF4E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4E2-6650HCL | Recombinant Human EIF4E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4E2 Products
Required fields are marked with *
My Review for All EIF4E2 Products
Required fields are marked with *
0
Inquiry Basket