Recombinant Full Length Human EIF4E2 Protein, C-Flag-tagged
Cat.No. : | EIF4E2-2032HFL |
Product Overview : | Recombinant Full Length Human EIF4E2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ubiquitin protein ligase binding activity. Involved in positive regulation of miRNA mediated inhibition of translation. Acts upstream of or within negative regulation of translation. Located in P-body. Part of mRNA cap binding activity complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.2 kDa |
AA Sequence : | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Insulin signaling pathway, mTOR signaling pathway |
Full Length : | Full L. |
Gene Name | EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens (human) ] |
Official Symbol | EIF4E2 |
Synonyms | 4EHP; IF4e; 4E-LP; h4EHP; EIF4EL3 |
Gene ID | 9470 |
mRNA Refseq | NM_004846.4 |
Protein Refseq | NP_004837.1 |
MIM | 605895 |
UniProt ID | O60573 |
◆ Recombinant Proteins | ||
Eif4e2-2787M | Recombinant Mouse Eif4e2 Protein, Myc/DDK-tagged | +Inquiry |
EIF4E2-1253R | Recombinant Rhesus Macaque EIF4E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4E2-2160H | Recombinant Human EIF4E2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF4E2-829H | Recombinant Human EIF4E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4E2-12379H | Recombinant Human EIF4E2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4E2-6650HCL | Recombinant Human EIF4E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4E2 Products
Required fields are marked with *
My Review for All EIF4E2 Products
Required fields are marked with *
0
Inquiry Basket