Recombinant Full Length Human EIF5A Protein, C-Flag-tagged

Cat.No. : EIF5A-1946HFL
Product Overview : Recombinant Full Length Human EIF5A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables U6 snRNA binding activity and protein N-terminus binding activity. Involved in several processes, including cellular response to virus; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and tumor necrosis factor-mediated signaling pathway. Located in annulate lamellae; cytoplasm; and nucleus. Part of nuclear pore.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 16.7 kDa
AA Sequence : MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA MTEEAAVAIKAMAK myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens (human) ]
Official Symbol EIF5A
Synonyms FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI
Gene ID 1984
mRNA Refseq NM_001143761.1
Protein Refseq NP_001137233.1
MIM 600187
UniProt ID P63241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF5A Products

Required fields are marked with *

My Review for All EIF5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon