Recombinant Full Length Human ELOVL2 Protein, GST-tagged

Cat.No. : ELOVL2-4224HF
Product Overview : Human ELOVL2 full-length ORF ( NP_060240.2, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 296 amino acids
Description : ELOVL2 (ELOVL Fatty Acid Elongase 2) is a Protein Coding gene. Among its related pathways are Fatty acid elongation and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and fatty acid elongase activity. An important paralog of this gene is ELOVL5.
Molecular Mass : 61 kDa
AA Sequence : MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLAITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELOVL2 ELOVL fatty acid elongase 2 [ Homo sapiens ]
Official Symbol ELOVL2
Synonyms ELOVL2; ELOVL fatty acid elongase 2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 2; elongation of very long chain fatty acids protein 2; Ssc2; ELOVL FA elongase 2; 3-keto acyl-CoA synthase ELOVL2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2; SSC2; FLJ20334;
Gene ID 54898
mRNA Refseq NM_017770
Protein Refseq NP_060240
MIM 611814
UniProt ID Q9NXB9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELOVL2 Products

Required fields are marked with *

My Review for All ELOVL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon