Recombinant Full Length Human EML2 Protein, GST-tagged

• Cat.No.: EML2-4245HF
• Product Overview: Human EML2 full-length ORF ( AAH32630, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 427 amino acids
• Description: EML2 (Echinoderm Microtubule Associated Protein Like 2) is a Protein Coding gene. GO annotations related to this gene include receptor binding and protein C-terminus binding. An important paralog of this gene is EML1.
• Molecular Mass: 72.71 kDa
• AA Sequence: MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEMAAAGHGDP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ]
• Official Symbol: EML2
• Synonyms: EML2; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT associated protein (EMAP) like protein 70; ELP70; EMAP 2; EMAP2; microtubule associated protein like echinoderm EMAP; microtubule-associated protein like echinoderm EMAP; echinoderm MT-associated protein (EMAP)-like protein 70; EMAP-2
• Gene ID: 24139
• mRNA Refseq: NM_001193268
• Protein Refseq: NP_001180197
• MIM: 617494
• UniProt ID: O95834