Recombinant Full Length Human EML2 Protein, GST-tagged

Cat.No. : EML2-4245HF
Product Overview : Human EML2 full-length ORF ( AAH32630, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 427 amino acids
Description : EML2 (Echinoderm Microtubule Associated Protein Like 2) is a Protein Coding gene. GO annotations related to this gene include receptor binding and protein C-terminus binding. An important paralog of this gene is EML1.
Molecular Mass : 72.71 kDa
AA Sequence : MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEMAAAGHGDP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ]
Official Symbol EML2
Synonyms EML2; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT associated protein (EMAP) like protein 70; ELP70; EMAP 2; EMAP2; microtubule associated protein like echinoderm EMAP; microtubule-associated protein like echinoderm EMAP; echinoderm MT-associated protein (EMAP)-like protein 70; EMAP-2;
Gene ID 24139
mRNA Refseq NM_001193268
Protein Refseq NP_001180197
MIM 617494
UniProt ID O95834

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EML2 Products

Required fields are marked with *

My Review for All EML2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon