Recombinant Human EML2 Protein, GST-tagged
Cat.No. : | EML2-3284H |
Product Overview : | Human EML2 full-length ORF ( AAH32630, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EML2 (Echinoderm Microtubule Associated Protein Like 2) is a Protein Coding gene. GO annotations related to this gene include receptor binding and protein C-terminus binding. An important paralog of this gene is EML1. |
Molecular Mass : | 72.71 kDa |
AA Sequence : | MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEMAAAGHGDP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ] |
Official Symbol | EML2 |
Synonyms | EML2; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT associated protein (EMAP) like protein 70; ELP70; EMAP 2; EMAP2; microtubule associated protein like echinoderm EMAP; microtubule-associated protein like echinoderm EMAP; echinoderm MT-associated protein (EMAP)-like protein 70; EMAP-2; |
Gene ID | 24139 |
mRNA Refseq | NM_001193268 |
Protein Refseq | NP_001180197 |
MIM | 617494 |
UniProt ID | O95834 |
◆ Recombinant Proteins | ||
EML2-3284H | Recombinant Human EML2 Protein, GST-tagged | +Inquiry |
Eml2-1554R | Recombinant Rat Eml2 protein, His & T7-tagged | +Inquiry |
EML2-3323Z | Recombinant Zebrafish EML2 | +Inquiry |
EML2-5180M | Recombinant Mouse EML2 Protein | +Inquiry |
EML2-2093R | Recombinant Rat EML2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EML2-247HCL | Recombinant Human EML2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EML2 Products
Required fields are marked with *
My Review for All EML2 Products
Required fields are marked with *