Recombinant Full Length Rabbit Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged
Cat.No. : | RFL10999OF |
Product Overview : | Recombinant Full Length Rabbit Epithelial membrane protein 1(EMP1) Protein (P54850) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-160) |
Form : | Lyophilized powder |
AA Sequence : | MLVLLAAIFVVHIATCVMLFVSTIANVWVVSDSINASVGLWRNCTSGDCSGGLSYGHEDA LKAVQAFMILSIIFSVISLIIFVFQLFTMEKGNRFFLSGATMLVCWLCVLIGASIYTHRY ANGDSNTFDRSHHGYSFILAWICFCFSFVVGVLYLVLRKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EMP1 |
Synonyms | EMP1; Epithelial membrane protein 1; EMP-1; Squamous cell-specific protein CL-20; Tumor-associated membrane protein |
UniProt ID | P54850 |
◆ Recombinant Proteins | ||
RFL10999OF | Recombinant Full Length Rabbit Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged | +Inquiry |
EMP1-2094R | Recombinant Rat EMP1 Protein | +Inquiry |
EMP1-5184M | Recombinant Mouse EMP1 Protein | +Inquiry |
RFL7502HF | Recombinant Full Length Human Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged | +Inquiry |
EMP1-4249HF | Recombinant Full Length Human EMP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMP1 Products
Required fields are marked with *
My Review for All EMP1 Products
Required fields are marked with *
0
Inquiry Basket