Recombinant Full Length Human EN1 Protein, GST-tagged
Cat.No. : | EN1-4285HF |
Product Overview : | Human EN1 full-length ORF ( AAI11841.1, 1 a.a. - 392 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 392 amino acids |
Description : | Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 69.52 kDa |
AA Sequence : | MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EN1 engrailed homeobox 1 [ Homo sapiens ] |
Official Symbol | EN1 |
Synonyms | EN1; engrailed homeobox 1; homeobox protein engrailed-1; hu-En-1; engrailed homolog 1; homeobox protein en-1; |
Gene ID | 2019 |
mRNA Refseq | NM_001426 |
Protein Refseq | NP_001417 |
MIM | 131290 |
UniProt ID | Q05925 |
◆ Recombinant Proteins | ||
EN1-301198H | Recombinant Human EN1 protein, GST-tagged | +Inquiry |
EN1-2963H | Recombinant Human EN1 Protein (Met1-Glu392), C-His tagged | +Inquiry |
EN1-5191M | Recombinant Mouse EN1 Protein | +Inquiry |
EN1-1199C | Recombinant Chicken EN1 Protein, His-B2M-tagged | +Inquiry |
EN1-3297H | Recombinant Human EN1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EN1 Products
Required fields are marked with *
My Review for All EN1 Products
Required fields are marked with *