Recombinant Full Length Human ENAH Protein, C-Flag-tagged
| Cat.No. : | ENAH-1810HFL |
| Product Overview : | Recombinant Full Length Human ENAH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 66.3 kDa |
| AA Sequence : | MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKY NQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEEL EIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERL ERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSV LGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTP EPIRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQ DILDEMRKELTKLKEELIDAIRQELSKSNTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Regulation of actin cytoskeleton |
| Full Length : | Full L. |
| Gene Name | ENAH ENAH actin regulator [ Homo sapiens (human) ] |
| Official Symbol | ENAH |
| Synonyms | ENA; MENA; NDPP1 |
| Gene ID | 55740 |
| mRNA Refseq | NM_001008493.3 |
| Protein Refseq | NP_001008493.1 |
| MIM | 609061 |
| UniProt ID | Q8N8S7 |
| ◆ Recombinant Proteins | ||
| ENAH-1505H | Recombinant Human ENAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ENAH-301160H | Recombinant Human ENAH protein, GST-tagged | +Inquiry |
| ENAH-5873C | Recombinant Chicken ENAH | +Inquiry |
| ENAH-3031H | Recombinant Human ENAH protein, His-tagged | +Inquiry |
| ENAH-840H | Recombinant Human ENAH Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENAH Products
Required fields are marked with *
My Review for All ENAH Products
Required fields are marked with *
