Recombinant Human ENAH protein, GST-tagged
Cat.No. : | ENAH-301160H |
Product Overview : | Recombinant Human ENAH protein(501-577 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 501-577 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEEL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ENAH enabled homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ENAH |
Synonyms | ENAH; enabled homolog (Drosophila); protein enabled homolog; FLJ10773; MENA; NDPP1; ENA; |
Gene ID | 55740 |
mRNA Refseq | NM_001008493 |
Protein Refseq | NP_001008493 |
MIM | 609061 |
UniProt ID | Q8N8S7 |
◆ Recombinant Proteins | ||
ENAH-1818H | Recombinant Human ENAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENAH-3031H | Recombinant Human ENAH protein, His-tagged | +Inquiry |
ENAH-1810HFL | Recombinant Full Length Human ENAH Protein, C-Flag-tagged | +Inquiry |
Enah-2819M | Recombinant Mouse Enah Protein, Myc/DDK-tagged | +Inquiry |
ENAH-840H | Recombinant Human ENAH Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENAH Products
Required fields are marked with *
My Review for All ENAH Products
Required fields are marked with *