Recombinant Full Length Human EPB41L4A Protein, GST-tagged
| Cat.No. : | EPB41L4A-4261HF |
| Product Overview : | Human EPB41L4A full-length ORF ( AAH31042.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 185 amino acids |
| Description : | The protein encoded by this gene is a member of the band 4.1 protein superfamily. Members of this superfamily are thought to play an important role in regulating interactions between the cytoskeleton and plasma membrane, and contain an amino terminal conserved domain that binds glycophorin C. This gene product is thought to be involved in the beta-catenin signaling pathway. [provided by RefSeq, Dec 2016] |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EPB41L4A erythrocyte membrane protein band 4.1 like 4A [ Homo sapiens ] |
| Official Symbol | EPB41L4A |
| Synonyms | EPB41L4A; erythrocyte membrane protein band 4.1 like 4A; band 4.1-like protein 4A; NBL4; erythrocyte protein band 4.1-like 4; EPB41L4; FLJ38738; DKFZp566L203; |
| Gene ID | 64097 |
| mRNA Refseq | NM_022140 |
| Protein Refseq | NP_071423 |
| MIM | 612141 |
| UniProt ID | Q9HCS5 |
| ◆ Recombinant Proteins | ||
| EPB41L4A-3358H | Recombinant Human EPB41L4A Protein, GST-tagged | +Inquiry |
| EPB41L4A-8823Z | Recombinant Zebrafish EPB41L4A | +Inquiry |
| EPB41L4A-4261HF | Recombinant Full Length Human EPB41L4A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPB41L4A-563HCL | Recombinant Human EPB41L4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPB41L4A Products
Required fields are marked with *
My Review for All EPB41L4A Products
Required fields are marked with *
