Recombinant Human EPB41L4A Protein, GST-tagged

Cat.No. : EPB41L4A-3358H
Product Overview : Human EPB41L4A full-length ORF ( AAH31042.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the band 4.1 protein superfamily. Members of this superfamily are thought to play an important role in regulating interactions between the cytoskeleton and plasma membrane, and contain an amino terminal conserved domain that binds glycophorin C. This gene product is thought to be involved in the beta-catenin signaling pathway. [provided by RefSeq, Dec 2016]
Molecular Mass : 47.8 kDa
AA Sequence : MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPB41L4A erythrocyte membrane protein band 4.1 like 4A [ Homo sapiens ]
Official Symbol EPB41L4A
Synonyms EPB41L4A; erythrocyte membrane protein band 4.1 like 4A; band 4.1-like protein 4A; NBL4; erythrocyte protein band 4.1-like 4; EPB41L4; FLJ38738; DKFZp566L203;
Gene ID 64097
mRNA Refseq NM_022140
Protein Refseq NP_071423
MIM 612141
UniProt ID Q9HCS5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPB41L4A Products

Required fields are marked with *

My Review for All EPB41L4A Products

Required fields are marked with *

0
cart-icon