Recombinant Full Length Human Epidermal Retinol Dehydrogenase 2(Sdr16C5) Protein, His-Tagged
Cat.No. : | RFL31748HF |
Product Overview : | Recombinant Full Length Human Epidermal retinol dehydrogenase 2(SDR16C5) Protein (Q8N3Y7) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF ARLGSVLVLWDINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVS ILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAG LSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPS LLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMD GFVDQKKKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SDR16C5 |
Synonyms | SDR16C5; RDHE2; Epidermal retinol dehydrogenase 2; EPHD-2; RDH-E2; Retinal short-chain dehydrogenase reductase 2; retSDR2; Short-chain dehydrogenase/reductase family 16C member 5 |
UniProt ID | Q8N3Y7 |
◆ Recombinant Proteins | ||
SDR16C5-3933R | Recombinant Rhesus Macaque SDR16C5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SDR16C5-4116R | Recombinant Rhesus monkey SDR16C5 Protein, His-tagged | +Inquiry |
SDR16C5-1709H | Recombinant Human SDR16C5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL31748HF | Recombinant Full Length Human Epidermal Retinol Dehydrogenase 2(Sdr16C5) Protein, His-Tagged | +Inquiry |
SDR16C5-7973M | Recombinant Mouse SDR16C5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDR16C5-2007HCL | Recombinant Human SDR16C5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDR16C5 Products
Required fields are marked with *
My Review for All SDR16C5 Products
Required fields are marked with *
0
Inquiry Basket