Recombinant Full Length Human ERMAP Protein, GST-tagged
Cat.No. : | ERMAP-4594HF |
Product Overview : | Human ERMAP full-length ORF ( NP_001017922.1, 1 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 475 amino acids |
Description : | The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 79 kDa |
AA Sequence : | MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERMAP erythroblast membrane-associated protein (Scianna blood group) [ Homo sapiens ] |
Official Symbol | ERMAP |
Synonyms | ERMAP; erythroblast membrane-associated protein (Scianna blood group); erythroblast membrane associated protein , erythroblast membrane associated protein (RD and SC blood groups) , Radin blood group , RD, SC, Scianna blood group; erythroid membrane-associated protein; Radin blood group (Rd); Scianna blood group (Sc); radin blood group antigen; scianna blood group antigen; RD; SC; PRO2801; MGC118810; MGC118811; MGC118812; MGC118813; |
Gene ID | 114625 |
mRNA Refseq | NM_001017922 |
Protein Refseq | NP_001017922 |
MIM | 609017 |
UniProt ID | Q96PL5 |
◆ Recombinant Proteins | ||
ERMAP-3480H | Recombinant Human ERMAP Protein, GST-tagged | +Inquiry |
ERMAP-7771H | Recombinant Human ERMAP, His-tagged | +Inquiry |
ERMAP-864H | Recombinant Human ERMAP Protein, His (Fc)-Avi-tagged | +Inquiry |
ERMAP-2640H | Recombinant Human ERMAP Protein (His30-Ala155), C-His tagged | +Inquiry |
ERMAP-4594HF | Recombinant Full Length Human ERMAP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERMAP-6549HCL | Recombinant Human ERMAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMAP Products
Required fields are marked with *
My Review for All ERMAP Products
Required fields are marked with *