Recombinant Human ERMAP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ERMAP-890H |
| Product Overview : | ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_061008) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. |
| Molecular Mass : | 52.6 kDa |
| AA Sequence : | MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ERMAP erythroblast membrane associated protein (Scianna blood group) [ Homo sapiens (human) ] |
| Official Symbol | ERMAP |
| Synonyms | ERMAP; erythroblast membrane-associated protein (Scianna blood group); erythroblast membrane associated protein, erythroblast membrane associated protein (RD and SC blood groups), Radin blood group, RD, SC, Scianna blood group; erythroid membrane-associated protein; Radin blood group (Rd); Scianna blood group (Sc); radin blood group antigen; scianna blood group antigen; RD; SC; PRO2801; MGC118810; MGC118811; MGC118812; MGC118813; |
| Gene ID | 114625 |
| mRNA Refseq | NM_018538 |
| Protein Refseq | NP_061008 |
| MIM | 609017 |
| UniProt ID | Q96PL5 |
| ◆ Recombinant Proteins | ||
| ERMAP-890H | Recombinant Human ERMAP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ERMAP-1867HFL | Recombinant Full Length Human ERMAP Protein, C-Flag-tagged | +Inquiry |
| ERMAP-3480H | Recombinant Human ERMAP Protein, GST-tagged | +Inquiry |
| ERMAP-4594HF | Recombinant Full Length Human ERMAP Protein, GST-tagged | +Inquiry |
| ERMAP-7771H | Recombinant Human ERMAP, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ERMAP-6549HCL | Recombinant Human ERMAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMAP Products
Required fields are marked with *
My Review for All ERMAP Products
Required fields are marked with *
