Recombinant Human ERMAP Protein, GST-tagged

Cat.No. : ERMAP-3480H
Product Overview : Human ERMAP full-length ORF ( NP_001017922.1, 1 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 79 kDa
AA Sequence : MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERMAP erythroblast membrane-associated protein (Scianna blood group) [ Homo sapiens ]
Official Symbol ERMAP
Synonyms ERMAP; erythroblast membrane-associated protein (Scianna blood group); erythroblast membrane associated protein , erythroblast membrane associated protein (RD and SC blood groups) , Radin blood group , RD, SC, Scianna blood group; erythroid membrane-associated protein; Radin blood group (Rd); Scianna blood group (Sc); radin blood group antigen; scianna blood group antigen; RD; SC; PRO2801; MGC118810; MGC118811; MGC118812; MGC118813;
Gene ID 114625
mRNA Refseq NM_001017922
Protein Refseq NP_001017922
MIM 609017
UniProt ID Q96PL5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERMAP Products

Required fields are marked with *

My Review for All ERMAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon