Recombinant Full Length Human ESM1 Protein, GST-tagged
| Cat.No. : | ESM1-4707HF |
| Product Overview : | Human ESM1 full-length ORF ( NP_008967.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 184 amino acids |
| Description : | This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
| Molecular Mass : | 46.5 kDa |
| AA Sequence : | MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ] |
| Official Symbol | ESM1 |
| Synonyms | ESM1; endothelial cell-specific molecule 1; ESM-1; endocan; |
| Gene ID | 11082 |
| mRNA Refseq | NM_001135604 |
| Protein Refseq | NP_001129076 |
| MIM | 601521 |
| UniProt ID | Q9NQ30 |
| ◆ Recombinant Proteins | ||
| ESM1-7082H | Recombinant Human ESM1, His-tagged | +Inquiry |
| Esm1-2871M | Recombinant Mouse Esm1 protein, His-SUMO-tagged | +Inquiry |
| Esm1-5144M | Recombinant Mouse Esm1 Protein (Tyr24-Arg184), N-His tagged | +Inquiry |
| Esm1-8703M | Recombinant Mouse ESM1 protein(Met1-Arg184), His-tagged | +Inquiry |
| ESM1-1806R | Recombinant Rat ESM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
| ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESM1 Products
Required fields are marked with *
My Review for All ESM1 Products
Required fields are marked with *
