Recombinant Full Length Human ESM1 Protein, GST-tagged

Cat.No. : ESM1-4707HF
Product Overview : Human ESM1 full-length ORF ( NP_008967.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 184 amino acids
Description : This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Molecular Mass : 46.5 kDa
AA Sequence : MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
Official Symbol ESM1
Synonyms ESM1; endothelial cell-specific molecule 1; ESM-1; endocan;
Gene ID 11082
mRNA Refseq NM_001135604
Protein Refseq NP_001129076
MIM 601521
UniProt ID Q9NQ30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ESM1 Products

Required fields are marked with *

My Review for All ESM1 Products

Required fields are marked with *

0
cart-icon