Recombinant Full Length Human ESM1 Protein, GST-tagged
Cat.No. : | ESM1-4707HF |
Product Overview : | Human ESM1 full-length ORF ( NP_008967.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 184 amino acids |
Description : | This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ] |
Official Symbol | ESM1 |
Synonyms | ESM1; endothelial cell-specific molecule 1; ESM-1; endocan; |
Gene ID | 11082 |
mRNA Refseq | NM_001135604 |
Protein Refseq | NP_001129076 |
MIM | 601521 |
UniProt ID | Q9NQ30 |
◆ Recombinant Proteins | ||
Esm1-6501M | Recombinant Mouse Esm1 Protein (Trp20-Arg184), C-His tagged | +Inquiry |
ESM1-2149R | Recombinant Rat ESM1 Protein | +Inquiry |
Esm1-476M | Active Recombinant Mouse Endothelial Cell-Specific Molecule 1, His-tagged | +Inquiry |
Esm1-2871M | Recombinant Mouse Esm1 protein, His-SUMO-tagged | +Inquiry |
ESM1-3500H | Recombinant Human ESM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESM1 Products
Required fields are marked with *
My Review for All ESM1 Products
Required fields are marked with *