Recombinant Full Length Human ESRRB Protein, C-Flag-tagged
Cat.No. : | ESRRB-1876HFL |
Product Overview : | Recombinant Full Length Human ESRRB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56 kDa |
AA Sequence : | MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP MHKLFLEMLEAKAWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGTAQAGYHLEVFL PQRAGWPRAA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Full Length : | Full L. |
Gene Name | ESRRB estrogen related receptor beta [ Homo sapiens (human) ] |
Official Symbol | ESRRB |
Synonyms | ERR2; ERRb; ESRL2; NR3B2; DFNB35; ERRbeta2; ERR beta-2 |
Gene ID | 2103 |
mRNA Refseq | NM_004452.4 |
Protein Refseq | NP_004443.3 |
MIM | 602167 |
UniProt ID | O95718 |
◆ Recombinant Proteins | ||
ESRRB-4345H | Recombinant Human ESRRB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ESRRB-1876HFL | Recombinant Full Length Human ESRRB Protein, C-Flag-tagged | +Inquiry |
ESRRB-2598H | Recombinant Human ESRRB protein, His-tagged | +Inquiry |
ESRRB-1812R | Recombinant Rat ESRRB Protein, His (Fc)-Avi-tagged | +Inquiry |
Esrrb-1091M | Recombinant Mouse Esrrb protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESRRB Products
Required fields are marked with *
My Review for All ESRRB Products
Required fields are marked with *
0
Inquiry Basket