Recombinant Human ESRRB protein, His-tagged
| Cat.No. : | ESRRB-2598H | 
| Product Overview : | Recombinant Human ESRRB protein(1-91 aa), fused to His tag, was expressed in E. coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-91 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC | 
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | ESRRB estrogen-related receptor beta [ Homo sapiens ] | 
| Official Symbol | ESRRB | 
| Synonyms | ESRRB; estrogen-related receptor beta; deafness, autosomal recessive 35 , DFNB35, ESRL2; steroid hormone receptor ERR2; ERR2; ERRb; ERRbeta; NR3B2; ERR-beta; ERRbeta-2; ERR beta-2; nuclear receptor ERRB2; orphan nuclear receptor; estrogen receptor-like 2; estrogen-related nuclear receptor beta; nuclear receptor subfamily 3 group B member 2; ESRL2; DFNB35; | 
| Gene ID | 2103 | 
| mRNA Refseq | NM_004452 | 
| Protein Refseq | NP_004443 | 
| MIM | 602167 | 
| UniProt ID | O95718 | 
| ◆ Recombinant Proteins | ||
| ESRRB-4345H | Recombinant Human ESRRB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ESRRB-2220H | Recombinant Human ESRRB Protein, MYC/DDK-tagged | +Inquiry | 
| ESRRB-3510H | Recombinant Human ESRRB Protein, GST-tagged | +Inquiry | 
| ESRRB-1876HFL | Recombinant Full Length Human ESRRB Protein, C-Flag-tagged | +Inquiry | 
| ESRRB-12561H | Recombinant Human ESRRB, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESRRB Products
Required fields are marked with *
My Review for All ESRRB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            