Recombinant Human ESRRB protein, His-tagged
Cat.No. : | ESRRB-2598H |
Product Overview : | Recombinant Human ESRRB protein(1-91 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-91 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ESRRB estrogen-related receptor beta [ Homo sapiens ] |
Official Symbol | ESRRB |
Synonyms | ESRRB; estrogen-related receptor beta; deafness, autosomal recessive 35 , DFNB35, ESRL2; steroid hormone receptor ERR2; ERR2; ERRb; ERRbeta; NR3B2; ERR-beta; ERRbeta-2; ERR beta-2; nuclear receptor ERRB2; orphan nuclear receptor; estrogen receptor-like 2; estrogen-related nuclear receptor beta; nuclear receptor subfamily 3 group B member 2; ESRL2; DFNB35; |
Gene ID | 2103 |
mRNA Refseq | NM_004452 |
Protein Refseq | NP_004443 |
MIM | 602167 |
UniProt ID | O95718 |
◆ Recombinant Proteins | ||
ESRRB-4345H | Recombinant Human ESRRB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ESRRB-3510H | Recombinant Human ESRRB Protein, GST-tagged | +Inquiry |
ESRRB-4723HF | Recombinant Full Length Human ESRRB Protein, GST-tagged | +Inquiry |
ESRRB-124H | Recombinant Human ESRRB, GST-tagged | +Inquiry |
Esrrb-1091M | Recombinant Mouse Esrrb protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESRRB Products
Required fields are marked with *
My Review for All ESRRB Products
Required fields are marked with *
0
Inquiry Basket