Recombinant Full Length Human ETV7 Protein, C-Flag-tagged
Cat.No. : | ETV7-785HFL |
Product Overview : | Recombinant Full Length Human ETV7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Dorso-ventral axis formation |
Full Length : | Full L. |
Gene Name | ETV7 ETS variant transcription factor 7 [ Homo sapiens (human) ] |
Official Symbol | ETV7 |
Synonyms | TEL2; TELB; TEL-2 |
Gene ID | 51513 |
mRNA Refseq | NM_016135.4 |
Protein Refseq | NP_057219.1 |
MIM | 605255 |
UniProt ID | Q9Y603 |
◆ Recombinant Proteins | ||
ETV7-4373HF | Recombinant Full Length Human ETV7 Protein, GST-tagged | +Inquiry |
ETV7-875H | Recombinant Human ETV7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV7-5344Z | Recombinant Zebrafish ETV7 | +Inquiry |
ETV7-785HFL | Recombinant Full Length Human ETV7 Protein, C-Flag-tagged | +Inquiry |
ETV7-3542H | Recombinant Human ETV7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV7-6518HCL | Recombinant Human ETV7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETV7 Products
Required fields are marked with *
My Review for All ETV7 Products
Required fields are marked with *
0
Inquiry Basket