Recombinant Human ETV7 Protein, GST-tagged

Cat.No. : ETV7-3542H
Product Overview : Human ETV7 full-length ORF ( NP_057219.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).[provided by RefSeq, May 2011]
Molecular Mass : 65.4 kDa
AA Sequence : MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ETV7 ets variant 7 [ Homo sapiens ]
Official Symbol ETV7
Synonyms ETV7; ets variant 7; ets variant gene 7 (TEL2 oncogene); transcription factor ETV7; TEL 2; TEL2; TEL2 oncogene; tel-related Ets factor; ETS-related protein Tel2; ETS translocation variant 7; Ets transcription factor TEL-2b; TELB; TEL-2;
Gene ID 51513
mRNA Refseq NM_001207035
Protein Refseq NP_001193964
MIM 605255
UniProt ID Q9Y603

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ETV7 Products

Required fields are marked with *

My Review for All ETV7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon